Protein Info for BWI76_RS26370 in Klebsiella michiganensis M5al

Annotation: aromatic amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 321 to 337 (17 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 23 to 394 (372 residues), 107.1 bits, see alignment E=1.2e-34 PF01490: Aa_trans" amino acids 24 to 247 (224 residues), 31.9 bits, see alignment E=6.1e-12

Best Hits

KEGG orthology group: None (inferred from 91% identity to kpn:KPN_03823)

Predicted SEED Role

"gamma-aminobutyrate (GABA) permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB37 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BWI76_RS26370 aromatic amino acid transporter (Klebsiella michiganensis M5al)
MSDNSTFSPVLTSRERTAVPAKSLSFIEGVSMIVGTNIGAGVLSIAYASSKAGFLPLLFW
LIVVGSLTTVTMLYVAESTLRTRKHLQLSGLSQRYVGRFGALMMFLSVCVNSVGALTAYM
TGSGKLLHSLFGISPALGSALFFIPAAGVLYLGLKAIGRGEKFISIGMVVMIAILVAATL
LQETASVGYLLDGNWLYMVPVFNVVAFCFSAQYIVPEMARGFADKPEKLPKAIMVGMLLT
FCLLALVPLSVIALSGLDNISDVATISWGRALGEWAFFSANLFALCAMLTSYWGLGGSFL
TNIFDQFRLGNDEQPFKRFKVLLVVAVPPFILAYSGMVSFVNALYFAGVFSGVILSIMPI
LILKGSRRQGDITPGWTCPALITHPFIQIFIVLLYLCSAVYAIASAFGYLPAGW