Protein Info for BWI76_RS26365 in Klebsiella michiganensis M5al

Annotation: branched chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 31 to 348 (318 residues), 67.7 bits, see alignment E=1.5e-22 PF13458: Peripla_BP_6" amino acids 31 to 349 (319 residues), 183 bits, see alignment E=2e-57 PF01094: ANF_receptor" amino acids 52 to 364 (313 residues), 88.9 bits, see alignment E=5.2e-29

Best Hits

Swiss-Prot: 94% identical to LIVJ_ECOLI: Leu/Ile/Val-binding protein (livJ) from Escherichia coli (strain K12)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 95% identity to kpu:KP1_5159)

MetaCyc: 94% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAQ9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BWI76_RS26365 branched chain amino acid ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MGSLRMNMKGKALLAGCIALIMSGTAMAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAIAD
INAKGGIKGNKLQMVKYDDACDPKQAVAVANKVINDGIKYVIGHLCSSSTQPASDIYEDE
GVLMITPAATAPELTARGYHLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGE
GLARAVQDNLKKGGANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQ
SRAAGLKTQFMGPEGVANVSLSNIAGASAEGMLVTKPKNYDQVPANKPIVDAIKAKKQDP
SGAFVWTTYAALQSLQAGLNQSEDPAEIAKYLKGATVDTVMGPLTWNEKGDLKGFEFGVF
TWHANGTATDAK