Protein Info for BWI76_RS26360 in Klebsiella michiganensis M5al

Annotation: aspartate 1-decarboxylase autocleavage activator PanM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF12568: PanZ" amino acids 2 to 124 (123 residues), 178 bits, see alignment E=5.5e-57 PF00583: Acetyltransf_1" amino acids 21 to 87 (67 residues), 26.4 bits, see alignment E=7.4e-10

Best Hits

Swiss-Prot: 71% identical to PANZ_SALTY: PanD regulatory factor (panM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_05510)

MetaCyc: 71% identical to PanD maturation factor (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"probable acetyltransferase YPO3809"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB05 at UniProt or InterPro

Protein Sequence (128 amino acids)

>BWI76_RS26360 aspartate 1-decarboxylase autocleavage activator PanM (Klebsiella michiganensis M5al)
MKLTIIRLQHFSDQDRIDLGKIWPSQDLAALPLDESHRIYAARFNERLLAAVRVTLNGVE
GELGALCVREVTRRRGVGQYLVEQALKDNPEITSWRIADVGVEDRGVMAAFMQALDFSAQ
TGGWVKNH