Protein Info for BWI76_RS26340 in Klebsiella michiganensis M5al

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details PF11862: DUF3382" amino acids 6 to 103 (98 residues), 90.4 bits, see alignment E=7.4e-30 PF02653: BPD_transp_2" amino acids 111 to 398 (288 residues), 219.7 bits, see alignment E=4.1e-69

Best Hits

Swiss-Prot: 96% identical to LIVM_SALTY: High-affinity branched-chain amino acid transport system permease protein LivM (livM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 95% identity to eco:b3456)

MetaCyc: 95% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivM (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAV0 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BWI76_RS26340 branched-chain amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MKPMHFAMALLSAVMFFILAGVFMGVQLELDGTKLVVDTAADIRWQWIYIGTAVVFFFQL
LRPVFQKTIKNVSGPKFILPAIDGSTVKQKLFLIALLVIAVAWPFMVSRGTVDIATLTMI
YIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYYGLGFWTCLPLAGLVSAAAGF
LLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEFSRSAR
EGGWDTFSNFFGVKYDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIA
CRSLGLSPTRIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVVLGGMG
SQFAVILAAVLLVVSRELMRDFNEYSMLMLGALMVLMMIWRPQGLLPMTRPQLKLKNGQA
KEGEQA