Protein Info for BWI76_RS26320 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 388 (362 residues), 146.7 bits, see alignment E=4.2e-47

Best Hits

Swiss-Prot: 52% identical to RHMT_ECOLI: Inner membrane transport protein RhmT (rhmT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 72% identity to ypk:y2602)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBI9 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BWI76_RS26320 MFS transporter (Klebsiella michiganensis M5al)
MKTITAYDNPALNSAITKSWKRLVPLMFILYFIAFIDRVNVGFAKEAMQVDIGLSNSAFA
LGAGIFFAAYALFGIPANLILNKIGAQKWLSITTVLWGVLSALTGLVQTETQFIVLRFLL
GLGEAGFYPGILLLASIYFPNKVRASVVGIFVLGVPLALTLGSPISGALLEMHGFLGRPG
WFWMFFIEGIPAVIMGIFAWFWLDDTPAKARFLNDEEKKALIAQLQQEQRQTETSNVGTA
LKSLKVWHLALIYGTIQISVYGLMFFLPSQVASLMGSTLGFKESLVAAIPWACSAVGVYY
IPRLADKMPARRVLISVICMLAAALGLFVSAWSGPVLAIAALSLSAIGFLSVQPIFWTFP
AQIVSGSALAASIGFCTTMGAFCSFLAPLIRVEVDAFFGNDSAGLVALSLITVCCALLIA
ALAGRKATNGVAVPHH