Protein Info for BWI76_RS26100 in Klebsiella michiganensis M5al

Annotation: DNA transporter HofQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 24 to 410 (387 residues), 405.4 bits, see alignment E=1.6e-125 PF07660: STN" amino acids 48 to 91 (44 residues), 28.9 bits, see alignment 1.2e-10 PF03958: Secretin_N" amino acids 124 to 181 (58 residues), 41.2 bits, see alignment E=2.3e-14 PF00263: Secretin" amino acids 251 to 410 (160 residues), 166.8 bits, see alignment E=5.3e-53

Best Hits

Swiss-Prot: 69% identical to HOFQ_ECOLI: DNA utilization protein HofQ (hofQ) from Escherichia coli (strain K12)

KEGG orthology group: K02507, protein transport protein HofQ (inferred from 82% identity to kpu:KP1_5092)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAP6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>BWI76_RS26100 DNA transporter HofQ (Klebsiella michiganensis M5al)
MMRWISLLFLLLPMMVDAVKKDLPVSLVVDDAPVAQVLQSLAELKQKNLVVAPDVSGTVS
LQLKEVPWQQALRSVIDSAGLTLTQQGSVLYVHTLVWQKAQQAQLEAERAKRLQNLPLQG
HSMSLRYADVEDLAKAGEKLLSARGHLTVDKRTNRLLIRDDAQHLPALIAWVQEMDVPVG
QVELAAHIVSMSETSLRELGVKWSLADASSPPGSGKLTTLSSNLAVGDASTRAGFNIGRI
GGRLLELELSALEQKQKVDIIASPRLLASHMQPASIKQGSEIPYQVSSGESGATSVEFKE
AVLGMEVTPTVLHHDRVRLKLRISENTPGQVLKQENGEVLAIDKQEIETQVEVKSGETLA
LGGIFAQKNKTSRDGIPLLGDIPWLGQLFRRDGKDNERRELVVFITPRILAVH