Protein Info for BWI76_RS26065 in Klebsiella michiganensis M5al

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00702: Hydrolase" amino acids 7 to 205 (199 residues), 130.4 bits, see alignment E=2.8e-41 PF12710: HAD" amino acids 10 to 202 (193 residues), 56.9 bits, see alignment E=9.3e-19 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 10 to 239 (230 residues), 307.2 bits, see alignment E=1.1e-95 PF13419: HAD_2" amino acids 10 to 210 (201 residues), 123.9 bits, see alignment E=1.9e-39 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 91 to 210 (120 residues), 55.1 bits, see alignment E=1.9e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 125 to 205 (81 residues), 38.4 bits, see alignment E=3.3e-13 PF13242: Hydrolase_like" amino acids 168 to 236 (69 residues), 45.7 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 87% identical to GPH_KLEAE: Phosphoglycolate phosphatase (gph) from Klebsiella aerogenes

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 88% identity to kva:Kvar_0345)

MetaCyc: 79% identical to phosphoglycolate phosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoglycolate phosphatase. [EC: 3.1.3.18]

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAJ9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>BWI76_RS26065 phosphoglycolate phosphatase (Klebsiella michiganensis M5al)
MDKLQNIRGVAFDLDGTLVDSAPGLTAAVDNALYALELPMAGEERVVTWIGNGADVLIQR
ALTWARQERAALRASQGKPSVDHDDIPQAEQQTILRKLFDRYYGEVAEEGSFLFPAVADT
LGALHAKGLPLALVTNKPTPFVAPILASLDIAKYFTVVIGGDDVKNKKPHPEPLLMVAEK
LGLAPAELLFVGDSRNDIQAAKAAGCRSIGLTYGYNYGEPISQSEPDYIFDQFNELLPAF
GLPYSETQE