Protein Info for BWI76_RS26025 in Klebsiella michiganensis M5al

Annotation: MFS transporter TsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 319 (306 residues), 80.9 bits, see alignment E=4.5e-27

Best Hits

Swiss-Prot: 92% identical to TSGA_ENT38: Protein TsgA homolog (tsgA) from Enterobacter sp. (strain 638)

KEGG orthology group: K06141, MFS transporter, TsgA protein (inferred from 94% identity to kpe:KPK_0365)

Predicted SEED Role

"TsgA protein homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAN1 at UniProt or InterPro

Protein Sequence (394 amino acids)

>BWI76_RS26025 MFS transporter TsgA (Klebsiella michiganensis M5al)
MTNSNRIKLTWISFFSYALTGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNSGILISI
FLNAWLMEIVPLKTQLRFSFILMVLAVAGLMFSHSLALFSASMFVLGLVSGITMSIGTFL
ITHMYEGRQRGARLLFTDSFFSMAGMIFPMLAAYLLARSIEWYWVYACIGLVYVAIFVLT
FGCEFPVLGKKALQESQPVAKEKWGIGVLFLSIAALCYILGQLGFISWVPEYAKGLGMSL
GDAGKLVSDFWMSYMIGMWSFSFILRFFDLQRILTVLAGVATVLMYLFINGSPEHMPWFI
LTLGFFSSAIYTSIITLGSLQTKVSSPKLVNFILTCGTVGTMLTFVVTGPIVAASGPLAA
LHTANVLYAVVFVMCLILGFVSRHRQNNAAAESH