Protein Info for BWI76_RS26005 in Klebsiella michiganensis M5al

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 187 (187 residues), 291.8 bits, E=1.2e-91
• PF00117: GATase
  • amino acids 3 to 185 (183 residues), 203.8 bits, E=2.1e-64
• PF07722: Peptidase_C26
  • amino acids 63 to 170 (108 residues), 29.6 bits, E=6.1e-11

Best Hits

Swiss-Prot: 97% identical to PABA_KLEAE: Aminodeoxychorismate synthase component 2 (pabA) from Klebsiella aerogenes

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 88% identity to esc:Entcl_0367)

MetaCyc: 81% identical to aminodeoxychorismate synthase subunit 2 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See A0A285BAT9 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BWI76_RS26005 glutamine amidotransferase (Klebsiella michiganensis M5al)
MILLIDNYDSFTWNLYQYFCELGAEVLVRRNDELTLADIIALAPAKIVISPGPCTPDESG
ISLAVIRHFSGKTPILGVCLGHQAIAQVFGAAIVRAAKVMHGKTSPVSHTGQGVFLGLNN
PLTVTRYHSLLIDPLTLPECFEVTARSEKGEIMGIRHRVFDLEGVQFHPESILSEQGHQL
LANFLNR