Protein Info for BWI76_RS25995 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 37 to 47 (11 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 390 to 406 (17 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 437 to 453 (17 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 674 (663 residues), 771 bits, see alignment E=5e-236 PF12805: FUSC-like" amino acids 63 to 330 (268 residues), 219.3 bits, see alignment E=9.2e-69 PF04632: FUSC" amino acids 376 to 660 (285 residues), 41.7 bits, see alignment E=1e-14 PF13515: FUSC_2" amino acids 377 to 498 (122 residues), 83.3 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 81% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_04735)

Predicted SEED Role

"FIG00731345: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB26 at UniProt or InterPro

Protein Sequence (692 amino acids)

>BWI76_RS25995 membrane protein (Klebsiella michiganensis M5al)
MWRRLIYHPEVNYALRQTLVLCLPVAIGLLFGHLQQGLLFSLVPACCNIAGLDTPHKRFF
KRLIIGGSLFAGCSLIVQLLLQREIPLPLILTGLALILGVTAEISSLHARLLPASLIAAI
FTLSLAGNMPVWEPLLIYALGTLWYGVFNWFWFWLWREQPLRESLSLLYRELANYCEAKY
SLLTQHTDPATSLPPLLNRQQKVVDLITQCYQQMHMLAANQRSDHKRLLRAFQVGLDLQE
HISVSLHQPEEVQKLVERSHAEAVIRWNAQTVAARLRELADDLLYHRYPRRFQMDKQIGA
LEKIAWQHPDNPVGQFCAWHFSRIARVLRTQRPLYARNLMADKTRRLPLLPALKNYLSLK
SPALRNAARISVMLSTASLMGSALHLPKPYWILMTVLFVTQNGYGATRVRIVHRAAGTIA
GLVIAGLTLHFHVPEGYTLTTMLFITLLSYLIIRQHYGWAMVGFTVTAVYTLQLLTLNGE
QFIVARLIDTLIGCLIAFGGMVWLWPQWQSGLLRKNAHDALEADQEAIRLILSDDHQAPA
LAYQRMRVNQTHNALFNSLNQAMQEPGFNSHYLEDMKLWVTHSQFIVEHINAMTTLAREH
NMLTPDLAQRYLESCEIALQRCQQRLDSDGPGSAGDVNIMEAQDAEVPRGPLSTMEQHLQ
RILGHLNTMHTISSVAWRQRPHHGIWLRATKR