Protein Info for BWI76_RS25960 in Klebsiella michiganensis M5al

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00293: NUDIX" amino acids 30 to 148 (119 residues), 46.8 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 82% identity to esa:ESA_04382)

Predicted SEED Role

"Nudix-related transcriptional regulator NrtR" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAV6 at UniProt or InterPro

Protein Sequence (239 amino acids)

>BWI76_RS25960 NUDIX hydrolase (Klebsiella michiganensis M5al)
MTTDAEYLSQYDASRFPSPLVTVDSVLFTLYEGALCVLLVERAHPPQQGAWGLPGGFIDL
AHDDSTRATALRKLTEKTGISPSWLEQLDTFSGPDRDPRGWSLTIAWFALISWVDCQPHI
ASVSDARWVPVAQLDSYSLAFDHQKIIDAGLHRLRQKTMYSLLPVYCLPETFTHGQLLEA
TEIILGQPIQRKSLIRRFEASGMFEETGETAATGARKARLWRRKSGVDFHLFSRNLLTD