Protein Info for BWI76_RS25945 in Klebsiella michiganensis M5al

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF00005: ABC_tran" amino acids 17 to 178 (162 residues), 85.9 bits, see alignment E=1.2e-27 amino acids 328 to 459 (132 residues), 88 bits, see alignment E=2.7e-28 PF12848: ABC_tran_Xtn" amino acids 217 to 299 (83 residues), 101.2 bits, see alignment E=8.1e-33

Best Hits

Swiss-Prot: 93% identical to YHES_ECO57: Uncharacterized ABC transporter ATP-binding protein YheS (yheS) from Escherichia coli O157:H7

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 93% identity to eco:b3352)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAL7 at UniProt or InterPro

Protein Sequence (634 amino acids)

>BWI76_RS25945 ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MIVFSSLQIRRGVRVLLDNATATINPGQKVGLVGKNGCGKSTLLSLLKNEISADGGSMTF
PGSWQLAWVNQETPALAQPAIDYVIDGDREFRKLEADLHAANERNDGHAIATVHGKLDAI
DAWTIRSRAASLLHGLGFSNEQLERPVSDFSGGWRMRLNLAQALICRSDLLLLDEPTNHL
DLDAVIWLEKWLKGYLGTLILISHDRDFLDPIVDKIIHIEQQTMFEYTGNYSSFEVQRAT
RLSQQQSMYESQQLRVAHLQSYIDRFRAKATKAKQAQSRIKMLERMELIAPAHVDNPFHF
SFRAPESLPNPLLKMEKVSAGYGERVILDSIKLNLVPGSRIGLLGRNGAGKSTLIKLLAG
ELQPLHGEIGLAKGIKLGYFAQHQLEFLRADESPLQHLARLAPQELEQKLRDYLGGFGFQ
SDKVNEQTQRFSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQALTEALIDFEGAL
VVVSHDRHLIRSTTDDLYLVHDSKVEPFDGDLEDYQQWLSDTQKQENQASEEPKENGNSA
QARKDQKRREAELRTQTQPLRKEIARLEKEMEKFNAQLAQAEEKLGDSELYDQSRKAELT
ACLQQQASAKSGLEECEMAWLDAQEQLEQMLQEG