Protein Info for BWI76_RS25930 in Klebsiella michiganensis M5al

Annotation: glutathione-regulated potassium-efflux system protein KefB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 373 (363 residues), 216 bits, see alignment E=7.8e-68 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 283 (270 residues), 299.2 bits, see alignment E=1.5e-93 PF02254: TrkA_N" amino acids 403 to 513 (111 residues), 84.8 bits, see alignment E=5.8e-28

Best Hits

Swiss-Prot: 93% identical to KEFB_KLEP3: Glutathione-regulated potassium-efflux system protein KefB (kefB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 92% identity to kva:Kvar_0366)

MetaCyc: 89% identical to K+ : H+ antiporter KefB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-42

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB15 at UniProt or InterPro

Protein Sequence (601 amino acids)

>BWI76_RS25930 glutathione-regulated potassium-efflux system protein KefB (Klebsiella michiganensis M5al)
MAGADLLLAGVLFLFAAVVAVPLAARLGIGAVLGYLLAGIAIGPWGLGFISDVDEILHFS
ELGVVFLMFIIGLELNPSKLWRLRSSIFGVGAAQVAFSALILGGLLMLSDFSWRAAVVGG
IGLAMSSTAMALQLMREKGMSRSESGQLGFSVLLFQDLAVIPALALVPLLAGSGDDHFNW
LTIGMKVLAFGGMLVGGRYLLRPVFRFIAGSGVREVFTAATLLLVLGSALFMDALGLSMA
LGTFIAGVLLAESEYRHELEIAIDPFKGLLLGLFFISVGMALNLGVLYTHLLWVVVSVAV
LVTVKGLVLYLLARVYGLRSSERVQFAGVLSQGGEFAFVLFSLPASLRLFQNDQMALLLV
TVTLSMMTTPLLMTLIDKVLSRRLNQPEEEGEAPWVEDDKPQVIIVGFGRFGQVIGRLLM
ANKMRITVLERDISAVNLMRKYGYKVYFGDATQLELLRSAGAEDAQSIVITCNEPEDTMK
LVEMCQQHFPHLHILARARGRVEAHELLQAGVAQFSRETFSSALELGRKALISLGMHPHQ
AQRAQLHFRRLDMRMLRELMPVHSDTLQISRVREARRELEEIFQREMQKESRQLDGWDEF
E