Protein Info for BWI76_RS25890 in Klebsiella michiganensis M5al

Annotation: sulfurtransferase TusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03011: sulfur relay protein TusB/DsrH
  • amino acids 2 to 95 (94 residues), 99.8 bits, E=3.8e-33
• PF04077: DsrH
  • amino acids 7 to 90 (84 residues), 94.5 bits, E=1.8e-31

Best Hits

Swiss-Prot: 80% identical to TUSB_KLEP7: Protein TusB (tusB) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07237, tRNA 2-thiouridine synthesizing protein B (inferred from 80% identity to kpu:KP1_5055)

MetaCyc: 59% identical to sulfurtransferase complex subunit TusB (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusB"

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)

Protein Sequence (95 amino acids)

>BWI76_RS25890 sulfurtransferase TusB (Klebsiella michiganensis M5al)
MLHTLSTSPWHADMATMRRLIKEGDDLLLLSDGVIAAIAEGRFLEILQSAPISIYALQED
IEARGLAGQIADSVIRVSYTEFVRLTVKHAGQLDW