Protein Info for BWI76_RS25885 in Klebsiella michiganensis M5al

Annotation: 30S ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 124 (124 residues), 233.3 bits, E=2.4e-74
• PF00164: Ribosom_S12_S23
  • amino acids 12 to 123 (112 residues), 146 bits, E=1.7e-47

Best Hits

Swiss-Prot: 100% identical to RS12_KLEP7: 30S ribosomal protein S12 (rpsL) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 99% identity to eco:b3342)

MetaCyc: 99% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Sequence Analysis Tools

See A0A285BAK6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>BWI76_RS25885 30S ribosomal protein S12 (Klebsiella michiganensis M5al)
MATINQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
RPKA