Protein Info for BWI76_RS25875 in Klebsiella michiganensis M5al

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 TIGR00484: translation elongation factor G" amino acids 1 to 703 (703 residues), 1284.2 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 214.7 bits, see alignment E=2.6e-67 TIGR00231: small GTP-binding protein domain" amino acids 10 to 187 (178 residues), 109 bits, see alignment E=2.1e-35 PF22042: EF-G_D2" amino acids 316 to 399 (84 residues), 61 bits, see alignment E=3e-20 PF03144: GTP_EFTU_D2" amino acids 331 to 398 (68 residues), 66.2 bits, see alignment E=8.5e-22 PF14492: EFG_III" amino acids 411 to 485 (75 residues), 114.2 bits, see alignment E=7.2e-37 PF03764: EFG_IV" amino acids 486 to 609 (124 residues), 152 bits, see alignment E=1.9e-48 PF00679: EFG_C" amino acids 611 to 696 (86 residues), 99.8 bits, see alignment E=2.2e-32

Best Hits

Swiss-Prot: 98% identical to EFG_CITK8: Elongation factor G (fusA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02355, elongation factor G (inferred from 98% identity to cko:CKO_04746)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAV3 at UniProt or InterPro

Protein Sequence (704 amino acids)

>BWI76_RS25875 elongation factor G (Klebsiella michiganensis M5al)
MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWSGMAKQYEPHRVNIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQ
PQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVGQIKTRLGANPVPLQLAIGAEEAFT
GVVDLVKMKAINWNEEDAGVTFTYEDIPADMQELAEEWHQNLIESAAEASEELMEKYLGG
EELTEEEIKTALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVVDYLPSPVDVPAINGILD
DGKDTPAERHASDDEPFAALAFKIATDPFVGNLTFFRVYSGVVNSGDTILNSVKAARERF
GRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDPNAPIILERMEFPEPVISIAV
EPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREFNVE
ANVGKPQVAYREAIRAKVTDIEGKHAKQSGGRGQYGHVVIDMYPLEPGSNPKGYEFINDI
KGGVIPGEYIPAVDKGIQEQLKAGPLAGYPVVDLGVRLHFGSYHDVDSSELAFKLAASIA
FKDGFKKAKPVLLEPIMKVEVETPEENTGDVIGDLSRRRGMLRGQESNVTGVVIHAEVPL
SEMFGYATQLRSLTKGRASYSMEFLKYDDAPNNVAQAVIEARGK