Protein Info for BWI76_RS25855 in Klebsiella michiganensis M5al
Annotation: bacterioferritin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to BFR_SALTY: Bacterioferritin (bfr) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K03594, bacterioferritin (inferred from 94% identity to see:SNSL254_A3712)MetaCyc: 88% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]
Predicted SEED Role
"Bacterioferritin" in subsystem Iron acquisition in Vibrio
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.16.3.1
Use Curated BLAST to search for 1.16.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285BAT4 at UniProt or InterPro
Protein Sequence (158 amino acids)
>BWI76_RS25855 bacterioferritin (Klebsiella michiganensis M5al) MKGDVKIISYLNKLLGNELVAINQYFLHARMFKNWGLMRLNDVEYHESIDEMKHADKYIE RILFLEGIPNLQDLGKLRIGEDVEEMLQSDLRLELEGAKDLREAIAYADSVHDYVSRDML ITILADEEGHIDWLETELDLIGKIGLQNYLQSQIKVAD