Protein Info for BWI76_RS25850 in Klebsiella michiganensis M5al

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01478: Peptidase_A24
  • amino acids 14 to 115 (102 residues), 83.1 bits, E=9e-28

Best Hits

Swiss-Prot: 55% identical to HOPD_ECOLX: Leader peptidase HopD (hopD) from Escherichia coli

KEGG orthology group: None (inferred from 62% identity to eae:EAE_04965)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

See A0A285BAF9 at UniProt or InterPro

Protein Sequence (158 amino acids)

>BWI76_RS25850 prepilin peptidase (Klebsiella michiganensis M5al)
MTVATFAFFIIHGGLLLTLCWHDLRYGLLPDKFTCPLLWSGLLYYLCLSPANLVQAVWGA
IGGYLAFGLIYWLYRGIRRREGIGYGDIKFLAALGAWHGWEVLPQLVLIAAILACAAVTA
LILCTRTRQTLHHPLPFGPFLAAAGVFCGWQTFISQPL