Protein Info for BWI76_RS25785 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 TIGR01079: ribosomal protein uL24" amino acids 3 to 103 (101 residues), 130.6 bits, see alignment E=1.4e-42 PF00467: KOW" amino acids 8 to 35 (28 residues), 25.5 bits, see alignment E=9e-10 PF17136: ribosomal_L24" amino acids 39 to 103 (65 residues), 89.6 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 99% identical to RL24_SALTY: 50S ribosomal protein L24 (rplX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02895, large subunit ribosomal protein L24 (inferred from 99% identity to eco:b3309)

MetaCyc: 99% identical to 50S ribosomal subunit protein L24 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L24p (L26e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAI6 at UniProt or InterPro

Protein Sequence (104 amino acids)

>BWI76_RS25785 50S ribosomal protein L24 (Klebsiella michiganensis M5al)
MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKLIVEGINLVKKHQKPVPALNQPGGIVE
KEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETIK