Protein Info for BWI76_RS25755 in Klebsiella michiganensis M5al

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 10 to 163 (154 residues), 236.7 bits, E=5e-75
• PF00333: Ribosomal_S5
  • amino acids 11 to 74 (64 residues), 103.7 bits, E=4.3e-34
• PF03719: Ribosomal_S5_C
  • amino acids 89 to 157 (69 residues), 105.2 bits, E=9.8e-35

Best Hits

Swiss-Prot: 100% identical to RS5_ENT38: 30S ribosomal protein S5 (rpsE) from Enterobacter sp. (strain 638)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 99% identity to eco:b3303)

MetaCyc: 99% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

See A0A285BAE3 at UniProt or InterPro

Protein Sequence (167 amino acids)

>BWI76_RS25755 30S ribosomal protein S5 (Klebsiella michiganensis M5al)
MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAI
QKAMEKARRNMINVALNHGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGV
HNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK