Protein Info for BWI76_RS25685 in Klebsiella michiganensis M5al

Annotation: Trk system potassium transport protein TrkA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF03807: F420_oxidored" amino acids 2 to 49 (48 residues), 21.7 bits, see alignment 1.5e-07 amino acids 234 to 280 (47 residues), 21.9 bits, see alignment 1.3e-07 PF02254: TrkA_N" amino acids 3 to 111 (109 residues), 99.8 bits, see alignment E=7.6e-32 amino acids 235 to 350 (116 residues), 93.3 bits, see alignment E=7.9e-30 PF02080: TrkA_C" amino acids 158 to 225 (68 residues), 44.2 bits, see alignment E=8.7e-15 amino acids 390 to 442 (53 residues), 35.2 bits, see alignment 5.6e-12 PF01488: Shikimate_DH" amino acids 233 to 325 (93 residues), 25.2 bits, see alignment E=9.1e-09 PF13241: NAD_binding_7" amino acids 233 to 319 (87 residues), 22.8 bits, see alignment E=6.9e-08

Best Hits

Swiss-Prot: 97% identical to TRKA_SALTY: Trk system potassium uptake protein TrkA (trkA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 98% identity to kpn:KPN_03690)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAG7 at UniProt or InterPro

Protein Sequence (458 amino acids)

>BWI76_RS25685 Trk system potassium transport protein TrkA (Klebsiella michiganensis M5al)
MKIIILGAGQVGGTLAENLVGENNDITLVDTNGDRLRSLQDKFDLRVVQGHGSHPRVLRE
AGADDADMLVAVTSSDETNMVACQVAYSLFNTPNRIARIRSPDYVRDADKLFHSEAVPID
HLIAPEQLVIDSIHRLIEYPGALQVVNFAEGKVSLAVVKAYYGGPLVGNALSTMREHMPH
IDTRVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQRLEKPYKRIMLVGG
GNIGAGLAHKLEKDYSVKLIERNQQRAAELAEKLQNTIVFYGDASDQELLAEEHIDQVDL
FIAVTNDDEANIMSAMLAKRMGAKKVMVLIQRRAYVDLVQGSVIDIAISPQQATISALLS
HVRKADIVGVSSLRRGVAEAIEAVAHGDESTSRVVGRAIDEIKLPPGTIIGAVVRGNDVM
IANNNLRIEQGDHVVMFLTDKKFISDVERLFQPSPFFL