Protein Info for BWI76_RS25650 in Klebsiella michiganensis M5al

Annotation: L-threonylcarbamoyladenylate synthase type 1 TsaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01300: Sua5_yciO_yrdC
  • amino acids 16 to 190 (175 residues), 162.3 bits, E=4.3e-52

Best Hits

Swiss-Prot: 86% identical to TSAC_KLEP7: Threonylcarbamoyl-AMP synthase (tsaC) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07566, putative translation factor (inferred from 86% identity to kpn:KPN_03683)

MetaCyc: 81% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Sequence Analysis Tools

See A0A285BAP5 at UniProt or InterPro

Protein Sequence (190 amino acids)

>BWI76_RS25650 L-threonylcarbamoyladenylate synthase type 1 TsaC (Klebsiella michiganensis M5al)
MNNNLPSEAIVRAVALLNNEHVIAYPTEAVFGVGCDPDSEKAVMSLLALKQRPVEKGLIL
IAANFEQLKPYIDDTQLSDAQLAAIFSCWPGPVTFVFPACASTPRWLTGRFNSLAVRVTD
HPLVVELCKAYGKPLVSTSANLSGQPPCRTTAEVYTQFGADFPVVDGATGGRQNPSEIRD
ALTGELFRQG