Protein Info for BWI76_RS25560 in Klebsiella michiganensis M5al

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00194: Carb_anhydrase
  • amino acids 32 to 245 (214 residues), 177.1 bits, E=2.6e-56

Best Hits

Swiss-Prot: 100% identical to CAH_KLEPN: Carbonic anhydrase (cah) from Klebsiella pneumoniae

KEGG orthology group: K01674, carbonic anhydrase [EC: 4.2.1.1] (inferred from 73% identity to ent:Ent638_3698)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See A0A285BB46 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS25560 carbonic anhydrase (Klebsiella michiganensis M5al)
MKTSLGKAALLALSMMPVTVFASHWSYEGEGSPEHWGALNEEYKTCQNGMNQSPINIDAT
FKTHLSPLDTHYIDGPITLINNGHTIQAALKTTTADTITIDGTPFILQQFHFHAPSENTV
HGKHYAMEMHLVHKNAKGAVAVVAVMFEQGAENTELNKLWATMPEQAEQTAKIVTQMDLN
ALLPIDKTYWRFSGSLTTPPCSEGVTWIVLKHPLTLSSAQLAKFSHAMHHDNNRPVQPLN
GRVVIE