Protein Info for BWI76_RS25555 in Klebsiella michiganensis M5al
Annotation: 50S ribosomal protein L11 methyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to PRMA_SALEP: Ribosomal protein L11 methyltransferase (prmA) from Salmonella enteritidis PT4 (strain P125109)
KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 92% identity to ecv:APECO1_3179)MetaCyc: 92% identical to ribosomal protein L11 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5419
Predicted SEED Role
"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285BAM4 at UniProt or InterPro
Protein Sequence (293 amino acids)
>BWI76_RS25555 50S ribosomal protein L11 methyltransferase (Klebsiella michiganensis M5al) MPWIQLKLNTTGANAEELSDALMEAGSVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLF DAETDMEEVVAILQQHPLLGVGFVHKIEQLEDKDWEREWMDNFHPMCFGQRLWICPSWRD VPDENAVNVMLDPGLAFGTGTHPTTAMCLQWLDGLDLAGKTIIDFGCGSGILAIAALKLG AAKAIGIDIDPQAIQASRDNAERNGVSERLELYLPKDQPEAMKADVVVANILAGPLRELA PLISVLPVTGGLLGLSGILASQAESVCEAYAELFELDPVVEKEEWCRITGYKK