Protein Info for BWI76_RS25550 in Klebsiella michiganensis M5al

Annotation: sodium:pantothenate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details TIGR02119: sodium/pantothenate symporter" amino acids 4 to 471 (468 residues), 740.3 bits, see alignment E=1e-226 PF00474: SSF" amino acids 36 to 432 (397 residues), 452.9 bits, see alignment E=5e-140 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 36 to 432 (397 residues), 361 bits, see alignment E=9e-112

Best Hits

Swiss-Prot: 85% identical to PANF_ECOLI: Sodium/pantothenate symporter (panF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_04710)

MetaCyc: 85% identical to pantothenate:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-117

Predicted SEED Role

"Pantothenate:Na+ symporter (TC 2.A.21.1.1)" in subsystem Coenzyme A Biosynthesis (TC 2.A.21.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAA1 at UniProt or InterPro

Protein Sequence (483 amino acids)

>BWI76_RS25550 sodium:pantothenate symporter (Klebsiella michiganensis M5al)
MQFEIIVVLLVYLLVVFGLSIYAMRKRSSGSFLSEYFLGSRSMGGFVLAMTLTATYISAS
SFIGGPGAAYKYGLGWVLLAMIQVPTIWLSLGILGKKFAILARRYNAITLNDMLQARYQS
RAVVWIASVSLLVAFVGAIAVQFIGGARLLETAAGIKYETGLLIFGITIALYTAFGGFRA
SVLNDTMQGMVMLIGTIVLLVGVVHAAGGLHNAVDTLQHIDPKLVSPHGANDILTPAFMT
SFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVLPH
LTVPDQVIPTLMVQVLPPWAAGLFLAAPMAAIMSNVNAHLLQASATIIKDLWLSAQPTKK
HNEQKLKRISTIATLVLGILMMLAAWRPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERA
NATGALSAMIVGGVLYAILATFNLQYLGFHPIVPSLLLSLLAFLVGNRFGTSAPQAAVLT
TDK