Protein Info for BWI76_RS25540 in Klebsiella michiganensis M5al

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 152.1 bits, see alignment E=2.2e-48 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 447 (447 residues), 827.2 bits, see alignment E=1.8e-253 PF02655: ATP-grasp_3" amino acids 114 to 294 (181 residues), 30.5 bits, see alignment E=1.1e-10 PF02786: CPSase_L_D2" amino acids 115 to 323 (209 residues), 281 bits, see alignment E=1.7e-87 PF07478: Dala_Dala_lig_C" amino acids 142 to 291 (150 residues), 31.8 bits, see alignment E=3.1e-11 PF02222: ATP-grasp" amino acids 145 to 292 (148 residues), 33.4 bits, see alignment E=1.1e-11 PF02785: Biotin_carb_C" amino acids 336 to 441 (106 residues), 131 bits, see alignment E=5.8e-42

Best Hits

Swiss-Prot: 96% identical to ACCC_ECOLI: Biotin carboxylase (accC) from Escherichia coli (strain K12)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 97% identity to eck:EC55989_3670)

MetaCyc: 96% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAD8 at UniProt or InterPro

Protein Sequence (449 amino acids)

>BWI76_RS25540 acetyl-CoA carboxylase biotin carboxylase subunit (Klebsiella michiganensis M5al)
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGEDMDVNRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCSKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDEHFQNGGTNIHYLEKKLGLQEK