Protein Info for BWI76_RS25515 in Klebsiella michiganensis M5al

Annotation: sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 107 to 266 (160 residues), 110 bits, see alignment E=5e-36

Best Hits

Swiss-Prot: 87% identical to MSRP_ESCF3: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K07147, (no description) (inferred from 92% identity to kpn:KPN_03661)

MetaCyc: 86% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAT6 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BWI76_RS25515 sulfoxide reductase (Klebsiella michiganensis M5al)
MKPKKLTEADVTAESVFMLQRRQVLKMLGISATALSLSPSAQADLLDWFKGNDRPPAPAG
KALTFDKPAQWQNNLTLTPEDKVSGYNNFYEFGLDKADPAANAGSLRTDPWTLTIGGEVA
KPLTLDHDDLTSRFPLEERIYRMRCVEAWSMVIPWVGFPLHKLLSLVEPTSNARYVAFKT
LYAPEQMPGQKDRFIGGGLAYPYVEGLRLDEAMHPLTLLSVGVYGKALPPQNGAPVRLTV
PWKYGFKGIKSIVSIELTRERPPTTWNLAGPEEYGFYANVNPHVDHPRWSQATERFIGAG
GVLDVKRQPTLLFNGYAEEVASLYRGLNLRENY