Protein Info for BWI76_RS25490 in Klebsiella michiganensis M5al

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 60 to 92 (33 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF04093: MreD" amino acids 5 to 155 (151 residues), 159.1 bits, see alignment E=5.1e-51 TIGR03426: rod shape-determining protein MreD" amino acids 9 to 154 (146 residues), 141.7 bits, see alignment E=9.2e-46

Best Hits

Swiss-Prot: 93% identical to MRED_ECOLI: Rod shape-determining protein MreD (mreD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_04655)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA87 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BWI76_RS25490 rod shape-determining protein MreD (Klebsiella michiganensis M5al)
MASYRSQGRWVIWLSFLIALLLQIMPWPADISVYRPNWVLLILLYWILALPHRVNVGTGF
VMGAILDLISGSTLGVRALSLSIVAYLVALKYQLFRNLALWQQALVVVMLSLAVDIIVFW
AEFLVINVSFRPEVFWSSVVNGVLWPWIFLLMRKVRQQFAVQ