Protein Info for BWI76_RS25465 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF08279: HTH_11" amino acids 5 to 46 (42 residues), 34 bits, see alignment 3.2e-12 PF08220: HTH_DeoR" amino acids 5 to 57 (53 residues), 65.2 bits, see alignment E=5.2e-22 PF00455: DeoRC" amino acids 76 to 232 (157 residues), 150.3 bits, see alignment E=7.1e-48

Best Hits

Swiss-Prot: 73% identical to FUCR_ECOLI: L-fucose operon activator (fucR) from Escherichia coli (strain K12)

KEGG orthology group: K02430, DeoR family transcriptional regulator, L-fucose operon activator (inferred from 74% identity to esc:Entcl_0464)

Predicted SEED Role

"L-fucose operon activator" in subsystem L-fucose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAS7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BWI76_RS25465 transcriptional regulator (Klebsiella michiganensis M5al)
MKAARQQQIVELLSQHHTLTTEALSQLLQVSIETVRRDLSELQKQGSIQRSHGQARVLLR
DNHNGEKPFHRRVKSHYAHKSDIARTALAWIDEGMTIALDASSTCWFLARQLPNSNLTVF
TNSHPVCVELGRRERIQLISAGGQLQRQYGYYVNPALLSQVKSLEIDLFIFSCEGIDNDG
VLWDSSANNAAYKSLLLKRAAQSLLLIDKSKFHRSGEVRIGNLRDVTQIISDAGPDNTLL
PFFAGSGR