Protein Info for BWI76_RS25460 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 226 to 244 (19 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 63 (60 residues), 72.2 bits, see alignment E=2.8e-24 PF03466: LysR_substrate" amino acids 89 to 291 (203 residues), 134 bits, see alignment E=4.9e-43

Best Hits

Swiss-Prot: 89% identical to AAER_ECOLI: HTH-type transcriptional activator AaeR (aaeR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to kpe:KPK_0466)

Predicted SEED Role

"LysR family transcriptional regulator QseA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAM0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>BWI76_RS25460 transcriptional regulator (Klebsiella michiganensis M5al)
MERLKRMSVFARVVELGSFTAAARQLQMSVSSISQTVAKLEDELQVKLLNRSTRSLGLTE
AGKIYYQGCRRMLFEVQDVHEQLYAFNNTPIGTLRIGCSSTMAQNVLARITADMLKEHPG
LSINLVTGIPAPDLIADGLDVVIRVGALQDSSLFSRRLGSMPMVLCAAKSYLQHAGCPEK
PADLASHSWLEYSVRPDNEFEIIAPEGISTKLIPQGRFVTNDPMTLVRWLTAGVGVAYVP
LMWAIEEINRGELEILLPSYQSDPRPVYALYTEKDKLPLKVQVCINYLTEYFVGVANIYQ
GMRGRGIAR