Protein Info for BWI76_RS25455 in Klebsiella michiganensis M5al

Annotation: protein AaeX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details PF07869: DUF1656" amino acids 7 to 61 (55 residues), 72.3 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 100% identical to AAEX_KLEP3: Protein AaeX (aaeX) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 100% identity to kpu:KP1_4967)

Predicted SEED Role

"probable membrane protein YPO3684"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAC3 at UniProt or InterPro

Protein Sequence (67 amino acids)

>BWI76_RS25455 protein AaeX (Klebsiella michiganensis M5al)
MSLFPVIVIFGLSFPPIFFELLLSLAIFWLVHRLLVPTGIYDFVWHPALFNTALYCCLFY
LISRLFV