Protein Info for BWI76_RS25405 in Klebsiella michiganensis M5al

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 93 to 123 (31 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 314 to 353 (40 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 6 to 413 (408 residues), 202 bits, see alignment E=7.4e-64 PF03600: CitMHS" amino acids 15 to 363 (349 residues), 227.1 bits, see alignment E=4.8e-71 amino acids 237 to 418 (182 residues), 88.4 bits, see alignment E=7.9e-29 PF06808: DctM" amino acids 221 to 413 (193 residues), 37.8 bits, see alignment E=1.6e-13 PF00939: Na_sulph_symp" amino acids 225 to 413 (189 residues), 73.9 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to kpe:KPK_0480)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAB4 at UniProt or InterPro

Protein Sequence (422 amino acids)

>BWI76_RS25405 anion transporter (Klebsiella michiganensis M5al)
MEPITITLCLLAFAIAMFVWEKIPLAVTSMVVCVALVLTGVLNLKQAFAGFIDTNVILFV
AMFIVGGALFETGMANKVGGVITRFAKTEKQLIFTIMVVVGVMSGFLSNTGTAAVLIPVV
IGVAAKSGFARSRLLMPLVFAAALGGNLSLIGAPGNLIAQSALQNIGSGFGFFEYAKVGL
PMLVCGMIYFLTIGYKFLPNHPNSGEVGSIGQQRDYSHVPRWKQILSLLVLIATILGMIF
EKQTGVSLAVAGCIGALVLVVTGVLTEKQAYKAIDSQTIFIFGGTLALAKALEMTGAGKL
VADHVIGLLGQNSSPFMLLVVVFALSVVMTNFMSNTATVALLVPVSLSIAAGMGADPRAV
LMATVIGSSCAYATPIGMPANMMVLTAGGYKFVDYAKSGIPLIIVSTIVSLILLPILFPF
HP