Protein Info for BWI76_RS25400 in Klebsiella michiganensis M5al

Annotation: L(+)-tartrate dehydratase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type" amino acids 11 to 282 (272 residues), 311.9 bits, see alignment E=1.7e-97 PF05681: Fumerase" amino acids 13 to 281 (269 residues), 275.7 bits, see alignment E=2e-86

Best Hits

Swiss-Prot: 54% identical to TTDA_ECOL5: L(+)-tartrate dehydratase subunit alpha (ttdA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03779, L(+)-tartrate dehydratase alpha subunit [EC: 4.2.1.32] (inferred from 99% identity to sek:SSPA3009)

MetaCyc: 54% identical to L(+)-tartrate dehydratase subunit alpha (Escherichia coli K-12 substr. MG1655)
L(+)-tartrate dehydratase. [EC: 4.2.1.32]

Predicted SEED Role

"L(+)-tartrate dehydratase alpha subunit (EC 4.2.1.32)" (EC 4.2.1.32)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.32

Use Curated BLAST to search for 4.2.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB14 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS25400 L(+)-tartrate dehydratase subunit alpha (Klebsiella michiganensis M5al)
MSKSEQISHMTNIMAKFVGYTGKVLPDDVTAKLEDLHKKETSKLADVIFTTMIENQRLAK
ELDRPSCQDTGVIQFLVECGANFPLIGELEALLREAVIKATVDSPLRHNSVETFDEYNTG
KNVGKGTPTVFWEIVPNSDQCSIYTYMAGGGCSLPGKAMVLMPGAGYEGVTRFVLDVMTS
YGLNACPPLLVGVGVATSVETAALLSKKALMRPIGSHNENERAASLEKMLEDGINKIGLG
PQGMSGNTSVMGVNIENTARHPSTIGVAVNVGCWSHRKGHIVFDKDLNYTITSHSGVNF