Protein Info for BWI76_RS25390 in Klebsiella michiganensis M5al

Annotation: oxaloacetate decarboxylase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01195: sodium pump decarboxylases, gamma subunit
  • amino acids 5 to 80 (76 residues), 86.2 bits, E=8.6e-29
• PF04277: OAD_gamma
  • amino acids 10 to 78 (69 residues), 73.6 bits, E=8.4e-25

Best Hits

Swiss-Prot: 89% identical to OADG3_SALTY: Oxaloacetate decarboxylase gamma chain 3 (oadG3) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 89% identity to stm:STM0766)

Predicted SEED Role

"Oxaloacetate decarboxylase gamma chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

• protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
• superpathway of vanillin and vanillate degradation (7/10 steps found)
• methylgallate degradation (4/6 steps found)
• syringate degradation (6/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

See A0A285AYC3 at UniProt or InterPro

Protein Sequence (82 amino acids)

>BWI76_RS25390 oxaloacetate decarboxylase subunit gamma (Klebsiella michiganensis M5al)
MTDAALLLGEGFTLMFLGMGFVLAFLFVLIFAIQGMSAAVNRFFPEPAPAPKAAPAAAPA
DDFARLTPVIAAAIHHHRRLNP