Protein Info for BWI76_RS25360 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF06295: ZapG-like" amino acids 6 to 126 (121 residues), 161.7 bits, see alignment E=4e-52

Best Hits

Swiss-Prot: 91% identical to YHCB_ECO57: Putative cytochrome d ubiquinol oxidase subunit 3 (yhcB) from Escherichia coli O157:H7

KEGG orthology group: K09908, hypothetical protein (inferred from 97% identity to kpu:KP1_4945)

Predicted SEED Role

"Putative cytochrome d ubiquinol oxidase subunit III (EC 1.10.3.-) (Cytochrome bd-I oxidase subunit III)" (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAJ8 at UniProt or InterPro

Protein Sequence (132 amino acids)

>BWI76_RS25360 hypothetical protein (Klebsiella michiganensis M5al)
MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQALQFELEKNKAELEEYREELVSHFARSA
ELLDNMAHDYRQLYQHMAKSSSNLLPDSMADANPFRNRLEESEAGNDQAPVQMPRDYSEG
ASGLLRGGVKRD