Protein Info for BWI76_RS25305 in Klebsiella michiganensis M5al

Annotation: TIGR01212 family radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR01212: radical SAM protein, TIGR01212 family" amino acids 6 to 300 (295 residues), 455.4 bits, see alignment E=4e-141 PF04055: Radical_SAM" amino acids 43 to 202 (160 residues), 74.8 bits, see alignment E=9.4e-25 PF16199: Radical_SAM_C" amino acids 208 to 291 (84 residues), 67.8 bits, see alignment E=7.3e-23

Best Hits

Swiss-Prot: 89% identical to YHCC_ECOLI: Protein YhcC (yhcC) from Escherichia coli (strain K12)

KEGG orthology group: K07139, (no description) (inferred from 89% identity to ecg:E2348C_3490)

Predicted SEED Role

"COG1242: Predicted Fe-S oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAI9 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BWI76_RS25305 TIGR01212 family radical SAM protein (Klebsiella michiganensis M5al)
MQLQKLVNMFGGDLMRRYGEKVHKLTLHGGFSCPNRDGTLGRGGCTFCNVASFADEEQQH
SSIAEQLAHQAQRVNRAKRYLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPD
CVPGAVLDLLSEYRQQGYEVWLELGLQTAHDKTLRRINRGHDFACYQRTARLARERGLKV
CSHLIVGLPGEGQSECLETLKQVVETGVDGIKLHPLHIVKGSIMARAWQAGRLQGIDLAD
YTVSAGEMIRHTPPEVIYHRISASARRPMLLAPLWCENRWTGMVELDKYLNEYGVQGSAI
GRCWRSPAATE