Protein Info for BWI76_RS25290 in Klebsiella michiganensis M5al

Annotation: monofunctional biosynthetic peptidoglycan transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR02070: monofunctional biosynthetic peptidoglycan transglycosylase" amino acids 11 to 230 (220 residues), 279.9 bits, see alignment E=7.2e-88 PF00912: Transgly" amino acids 61 to 226 (166 residues), 179.1 bits, see alignment E=2.9e-57

Best Hits

Swiss-Prot: 99% identical to MTGA_KLEOX: Biosynthetic peptidoglycan transglycosylase (mtgA) from Klebsiella oxytoca

KEGG orthology group: None (inferred from 87% identity to eae:EAE_04470)

MetaCyc: 81% identical to peptidoglycan glycosyltransferase MtgA (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129, 2.4.2.-

Use Curated BLAST to search for 2.4.1.129 or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAH1 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS25290 monofunctional biosynthetic peptidoglycan transglycosylase (Klebsiella michiganensis M5al)
MTFRFSPLRLIKRFLLRLLLACAVLWGGGVALFSIVPVPFSAVMLERQLGAWLSGNFHYI
AHSDWVGMDEISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNENRIRGASTLSQ
QTAKNLFLWDGRSWLRKGLEAGLTVGIETVWSKKRILTVYLNIAEFGEGTFGVEAASQRY
FHKPASRLTAAEAALLAAVLPNPIRFRADAPSGYIRSRQAWILRQMRQLGGEGFMRANQL
H