Protein Info for BWI76_RS25285 in Klebsiella michiganensis M5al

Annotation: HPr family phosphocarrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 TIGR01003: phosphocarrier, HPr family" amino acids 4 to 84 (81 residues), 72 bits, see alignment E=1.5e-24 PF00381: PTS-HPr" amino acids 4 to 84 (81 residues), 84.2 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 99% identical to PTSO_KLEOX: Phosphocarrier protein NPr (ptsO) from Klebsiella oxytoca

KEGG orthology group: K08485, phosphocarrier protein NPr (inferred from 92% identity to ecr:ECIAI1_3354)

Predicted SEED Role

"Phosphocarrier protein, nitrogen regulation associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA47 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BWI76_RS25285 HPr family phosphocarrier protein (Klebsiella michiganensis M5al)
MTVKQTVEITNKLGMHARPAMKLFELMQNYDAEVLLRNDEGTVAEANSVIALLMLDSAKG
RQIEIEANGPQEVEALAAVIALFNAGFDED