Protein Info for BWI76_RS25255 in Klebsiella michiganensis M5al

Annotation: lipopolysaccharide ABC transporter substrate-binding protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03002: lipopolysaccharide transport periplasmic protein LptA
  • amino acids 27 to 166 (140 residues), 174.5 bits, E=5.6e-56
• PF03968: LptD_N
  • amino acids 37 to 149 (113 residues), 121.4 bits, E=2.3e-39

Best Hits

Swiss-Prot: 86% identical to LPTA_ECOL6: Lipopolysaccharide export system protein LptA (lptA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_04435)

MetaCyc: 86% identical to lipopolysaccharide transport system protein LptA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

See A0A285BAI0 at UniProt or InterPro

Protein Sequence (181 amino acids)

>BWI76_RS25255 lipopolysaccharide ABC transporter substrate-binding protein LptA (Klebsiella michiganensis M5al)
MKFRTNKLSLKIALASALLAASLSAQAKTGDTDQPIHIESDQQSLDMQGNVVTFTGNVVV
TQGTIKINADKVVVTRPGGEKGKEVIDGYGNPATFYQMQDNGKPVKGRASKMHYELQNDF
VVLTGNAHLEQIDSNIQGDKITYLVKEQKMQAFSNKGGRVTTVLVPSQLQDKGSDQSKKG
K