Protein Info for BWI76_RS25200 in Klebsiella michiganensis M5al

Annotation: UDP-N-acetylglucosamine 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR01072: UDP-N-acetylglucosamine 1-carboxyvinyltransferase" amino acids 1 to 415 (415 residues), 613.9 bits, see alignment E=6.5e-189 PF00275: EPSP_synthase" amino acids 6 to 406 (401 residues), 467.1 bits, see alignment E=2.4e-144

Best Hits

Swiss-Prot: 98% identical to MURA_KLEP3: UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00790, UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC: 2.5.1.7] (inferred from 98% identity to kpe:KPK_0522)

MetaCyc: 91% identical to UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 1-carboxyvinyltransferase. [EC: 2.5.1.7]

Predicted SEED Role

"UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.5.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA71 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BWI76_RS25200 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Klebsiella michiganensis M5al)
MDKFRVQGPTRLQGEVTISGAKNAALPILFSALLAEEPIEIQNVPKLKDIDTTMKLLSQL
GANVKRNGSVWIDAGPVDVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT
VIENAAREPEIVDTANFLNALGAKIKGQGTDRITIEGVARLGGGVYRVLPDRIETGTFLV
AAAISGGKILCRNAQPDTLDAVLAKLRDAGADIETGEDWISLDMHGNRPKAVNVRTAPHP
GFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHIPELIRMGAHAEIESNTAICHGVKQL
SGAQVMATDLRASASLVLAGCIAEGTTIVDRIYHIDRGYERIEDKLQALGANIERVKAE