Protein Info for BWI76_RS25100 in Klebsiella michiganensis M5al

Annotation: ribosome maturation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF02576: RimP_N" amino acids 12 to 82 (71 residues), 98.6 bits, see alignment E=2.2e-32 PF17384: DUF150_C" amino acids 85 to 150 (66 residues), 82.6 bits, see alignment E=1.8e-27

Best Hits

Swiss-Prot: 97% identical to RIMP_KLEP3: Ribosome maturation factor RimP (rimP) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 95% identity to eco:b3170)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAK4 at UniProt or InterPro

Protein Sequence (150 amino acids)

>BWI76_RS25100 ribosome maturation factor (Klebsiella michiganensis M5al)
MSTLEQKLTEMLTAPVEALGFELVGIEFIRGRTSTLRIYIDSDDGINVDDCADVSHQVSA
VMDVEDPITVAYNLEVSSPGLDRPMFTAEHYERFIGEEVSLVLRMAVQNRRKWQGLIKAV
DGEMITVTVEGKDEVFALSNIQKANLVPHF