Protein Info for BWI76_RS25090 in Klebsiella michiganensis M5al

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 896 PF04760: IF2_N" amino acids 1 to 52 (52 residues), 40.8 bits, see alignment 6.2e-14 amino acids 320 to 370 (51 residues), 60.4 bits, see alignment 4.5e-20 PF08364: IF2_assoc" amino acids 57 to 95 (39 residues), 62.9 bits, see alignment (E = 9.8e-21) TIGR00487: translation initiation factor IF-2" amino acids 312 to 895 (584 residues), 979.5 bits, see alignment E=6.7e-299 PF00009: GTP_EFTU" amino acids 399 to 555 (157 residues), 128.5 bits, see alignment E=9.7e-41 TIGR00231: small GTP-binding protein domain" amino acids 399 to 554 (156 residues), 114.5 bits, see alignment E=4.2e-37 PF01926: MMR_HSR1" amino acids 400 to 505 (106 residues), 39.9 bits, see alignment E=1.6e-13 PF00071: Ras" amino acids 401 to 556 (156 residues), 22.7 bits, see alignment E=2.6e-08 PF11987: IF-2" amino acids 671 to 785 (115 residues), 145.4 bits, see alignment E=2.9e-46 PF03144: GTP_EFTU_D2" amino acids 816 to 883 (68 residues), 38 bits, see alignment 7.5e-13

Best Hits

Swiss-Prot: 91% identical to IF2_CITK8: Translation initiation factor IF-2 (infB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 95% identity to esc:Entcl_0529)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAK8 at UniProt or InterPro

Protein Sequence (896 amino acids)

>BWI76_RS25090 translation initiation factor IF-2 (Klebsiella michiganensis M5al)
MTDVTIKALASEIQTSVDRLIQQFADAGIRKSADDSVTAQEKQTLLTHLNREHGSAPDKL
TLQRKTRSTLNIPGTGGKSKSVQIEVRKKRTFVKRDPQEAERLAAEEQAQREAEEQARRE
AEESAKREAQLKAEREAAEQAKRELADKAKREAAEKDKVSNQQTDDMTKTAQAEKQRREN
EAAELKRKSEEEARRKLEEEARRVAEEARRMAQENEKNWTEAPETPEETTDYHVTTSQHA
RQAEDDNDREVEGGRGRGRNAKAARPAKKGNKHAESKADREEARAAVRGGKGGKHRKGSA
LQQGFQKPAQAVNRDVIIGETITVGDLANKMAVKGSQVIKAMMKLGAMATINQVIDQETA
QLVAEEMGHKVILRRENELEEAVMSDRDTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRST
KVASGEAGGITQHIGAYHVETDNGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDG
VMPQTIEAIQHAKAAQVPLVVAVNKIDKPEADLDRVKNELSQYGVMPEEWGGEAQFIPVS
AKAGTGIDDLLNAILLQAEVLELKAVRNGMASGAVIESFLDKGRGPVATVLVREGTLHKG
DIVLCGFEYGRVRAMRNELGLEVLEAGPSIPVEILGLSGVPAAGDEVTVVRDEKKAREVA
LYRQGKFREVKLARQQKSKLENMFANMTEGEVHEVNIVLKADVQGSVEAISDSLLKLSTD
EVKVKIIGSGVGGITETDATLAAASNAILVGFNVRADASARKVIDAESLDLRYYSVIYHL
IDEVKAAMSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGTIKRHNPIRVLRDN
VVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIQRTID