Protein Info for BWI76_RS25035 in Klebsiella michiganensis M5al

Annotation: malonate transporter subunit MadM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details TIGR00808: malonate transporter, MadM subunit" amino acids 5 to 253 (249 residues), 363.1 bits, see alignment E=4.1e-113 PF03818: MadM" amino acids 11 to 253 (243 residues), 384.4 bits, see alignment E=1.1e-119

Best Hits

KEGG orthology group: None (inferred from 93% identity to efe:EFER_3136)

Predicted SEED Role

"Malonate transporter, MadM subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAK1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS25035 malonate transporter subunit MadM (Klebsiella michiganensis M5al)
MEQLTKILTGSFTSNGLITAFVVVGIVCWAASWISTHLLRGKIHSSAIAIVAGLLLAWLG
GELTGGKKGLADISLFSGIALMGGGMFRDFAIISTAFGVKLEELKKAGMAGALALVISTV
LSFYLGAIVAWAFGYTDAISMATIGAGAVTFIVGPVTGAALGASSDVIALSIAAGVIKSI
AVMILTPLVAKAAGLNSPAAAIVYGGLMGSTSGVAAGLAATDPKLVPYGAMTATFYTGLG
CLLAPSALYLSLTPFF