Protein Info for BWI76_RS24980 in Klebsiella michiganensis M5al
Annotation: LLM class flavin-dependent oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to YHBW_ECOLI: Luciferase-like monooxygenase (yhbW) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 94% identity to enc:ECL_04542)Predicted SEED Role
"Luciferase-like monooxygenase (EC 1.14.-.-)" (EC 1.14.-.-)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Ascorbate and aldarate metabolism
- Benzoxazinone biosynthesis
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of steroids
- Biosynthesis of terpenoids and steroids
- Brassinosteroid biosynthesis
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Limonene and pinene degradation
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Sphingolipid metabolism
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.-.-
Use Curated BLAST to search for 1.14.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285BA28 at UniProt or InterPro
Protein Sequence (335 amino acids)
>BWI76_RS24980 LLM class flavin-dependent oxidoreductase (Klebsiella michiganensis M5al) MTDKPVSFSVLDLAPIPQGSSAKEAFSHSLDLAQLAEKRGYHRYWLAEHHNMVGIASAAT SVLIGYLAANTTTLHLGSGGVMLPNHSPLVIAEQFGTLNTLYPGRIDLGLGRAPGSDQPT MRALRRHMSGDVDNFPRDVAELVDWFDARDPNPHVRPVPGYGEKIPVWLLGSSLYSAQLA AQLGLPFAFASHFAPDMLFQALHLYRTHFQPSERLEKPYAMVCINIIAADSDRDAEFLFT SVQQAFVKLRRGETGQLPPPVQNMHQLWSASEQYGVQKALSMSLVGDKTKIRHGLESILR ETQADEIMVNGQIFDHQARLHSFDLAMQVKEALLG