Protein Info for BWI76_RS24915 in Klebsiella michiganensis M5al

Annotation: penicillin-binding protein activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF04348: LppC" amino acids 40 to 286 (247 residues), 149.6 bits, see alignment E=7.3e-48 amino acids 376 to 687 (312 residues), 275.8 bits, see alignment E=4.2e-86

Best Hits

Swiss-Prot: 80% identical to LPOA_KLEP7: Penicillin-binding protein activator LpoA (lpoA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K07121, (no description) (inferred from 81% identity to kva:Kvar_0542)

Predicted SEED Role

"LppC putative lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA85 at UniProt or InterPro

Protein Sequence (693 amino acids)

>BWI76_RS24915 penicillin-binding protein activator (Klebsiella michiganensis M5al)
MVPSTFLRSKPVRCLPVLLAALIFAGCGTHTPDQSTAYLQGTAQADSSYYLQQMQQSAND
SKTNWQLLAIRALLKEGKKPQAVDLFNQLPSNLNAAQSRERSLLAVEVKLAQNDFQGAQT
LLSKLDPASLEQNQQPRYWQAQIDASQGQPSLNLLRALIAQQPLLSLPAQKQKNIDATWK
ALTAMTKDQANALVINADENVLQGWLDLQRMWFDNRNDPTMLKAGVKDWQTRYPQNPGAK
MLPTQLVNMQNYQAASTNKIALLLPLNGQAAIFGRTIQQGFEAAKNGAPAVAGSAVPAQV
AQAANVAESAVVSPSQAEVTDLTTTNNAQPPVQTPAADQAQPAAPVTAPAAVQAPTPEAT
SQPAEAPQAQAVAATPANPSAELKIYDTTTQPMSQLLAQVQQDGATIVVGPLLKDNVEQV
IKSNTSLNVLALNQPEKIESRANICYFALSPEDEARDAAHHIHDQGKQTPLLLVPRGALG
DRVVTAFANEWLKLGGGTVLQQRLGSTAELRGSVNSGISLSGTPVSTLPSGQDSALGSPS
DVPVSSTGGVDAAYILATPEQIAYIKPMIALRNGSQSGVTLYASSRSAQGTSGPDFRLEM
EGLQYSEIPMLAGSNPALQQQALAAVRNDYSLARLYAMGADAWSLANHFSQMRQVPGFEL
NGNTGDLTATQDCVINRKLSWLKYQGGQIVAAN