Protein Info for BWI76_RS24905 in Klebsiella michiganensis M5al

Annotation: filamentation induced by cAMP protein fic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF02661: Fic" amino acids 101 to 196 (96 residues), 73.4 bits, see alignment E=4.6e-24 PF13412: HTH_24" amino acids 277 to 318 (42 residues), 27.6 bits, see alignment 3.6e-10 PF04703: FaeA" amino acids 278 to 330 (53 residues), 21.3 bits, see alignment 5.6e-08 PF08279: HTH_11" amino acids 278 to 317 (40 residues), 33.1 bits, see alignment 8.4e-12

Best Hits

KEGG orthology group: None (inferred from 70% identity to esc:Entcl_0553)

Predicted SEED Role

"Type I restriction-modification system, specificity subunit S (EC 3.1.21.3)" in subsystem Restriction-Modification System (EC 3.1.21.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.3

Use Curated BLAST to search for 3.1.21.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAG5 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BWI76_RS24905 filamentation induced by cAMP protein fic (Klebsiella michiganensis M5al)
MSHYQPPFSITPAILNLVVEIGELLGHWSAQTGRASPLLRKENRIRTIQASLAIEHNSLS
TDQVTALVEGKRVLAPAKDIQEVRNAILAYEKMPAWKSHRLTDLLTAHRTLMIGLVDNPG
QLRDGDVGIYRDTRLVHMAPPASQVERLINELLLWLKVTDIHPLIAGAVFHYEFEFIHPF
ADGNGRMGRLWQTLILSQWRAELAWLPVETLMHYQQERYYQVLGMCDSQSDSTPFIEFML
ENMVIALKDGMGQTASLSEEMSEKMSEEKVEMLAAVEERILKLLSKEPTRTAKDMAQEMD
VSARTVERYLKTLQQKGRLQRTGAKKRGAWRIL