Protein Info for BWI76_RS24895 in Klebsiella michiganensis M5al

Annotation: galactitol-1-phosphate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF08240: ADH_N" amino acids 26 to 130 (105 residues), 98.3 bits, see alignment E=4.6e-32 PF16912: Glu_dehyd_C" amino acids 140 to 265 (126 residues), 38.6 bits, see alignment E=1.7e-13 PF01262: AlaDh_PNT_C" amino acids 157 to 227 (71 residues), 31.5 bits, see alignment E=2.5e-11 PF00107: ADH_zinc_N" amino acids 172 to 307 (136 residues), 87.7 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 67% identical to GATD_ECOLI: Galactitol 1-phosphate 5-dehydrogenase (gatD) from Escherichia coli (strain K12)

KEGG orthology group: K00094, galactitol-1-phosphate 5-dehydrogenase [EC: 1.1.1.251] (inferred from 91% identity to kva:Kvar_0546)

MetaCyc: 67% identical to galactitol-1-phosphate 5-dehydrogenase (Escherichia coli K-12 substr. MG1655)
Galactitol-1-phosphate 5-dehydrogenase. [EC: 1.1.1.251]

Predicted SEED Role

"Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)" in subsystem D-Tagatose and Galactitol Utilization (EC 1.1.1.251)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAG8 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BWI76_RS24895 galactitol-1-phosphate 5-dehydrogenase (Klebsiella michiganensis M5al)
MQSVVIHAEGTVRVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDLQPGDAVACVPLLPCFNCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDRMPIDDGAFIEPMTVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGAKSITAIDINPQRLALAKTLGATYVFNSKEMSSKEIQTALEEIQFDQLVLETAGTP
QTVALGIEVAGPRAQLALVGTLHHDLTLLSATFGQILRKELTIVGSWMNYSGPWPGEEWQ
TAVRLLTEKRIQLVPLIAHIGNAESFAREVQALNGAPMQGKILLKLS