Protein Info for BWI76_RS24865 in Klebsiella michiganensis M5al

Annotation: PTS family enzyme IIB'BC, fructose-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 138 to 158 (21 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 207 to 235 (29 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 5 to 87 (83 residues), 101.3 bits, see alignment E=2.8e-33 PF02302: PTS_IIB" amino acids 6 to 95 (90 residues), 63.8 bits, see alignment E=1.9e-21 TIGR01427: PTS system, Fru family, IIC component" amino acids 114 to 453 (340 residues), 375.2 bits, see alignment E=3.7e-116 PF02378: PTS_EIIC" amino acids 133 to 399 (267 residues), 55.8 bits, see alignment E=4.3e-19

Best Hits

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 94% identity to kva:Kvar_0552)

MetaCyc: 58% identical to tagatose-specific PTS enzyme IIBC component (Bacillus licheniformis)
2.7.1.-

Predicted SEED Role

"PTS system, tagatose-specific IIBC component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA81 at UniProt or InterPro

Protein Sequence (470 amino acids)

>BWI76_RS24865 PTS family enzyme IIB'BC, fructose-specific (Klebsiella michiganensis M5al)
MKKIIAVTGCPTGIAHTFMAEEALKTAAKKLNIEIKVETNGASGVENAITPADLKDIYGV
IIAADKDVNAERFNGLPVIEVPVKEAIHHPADLINKFISGQAARRQGISASDDSTEKYER
ESFGRQVYKHLMSGVSNMLPFVVAGGILIAISFLWGIYSADPNSPQYNVIAATLMKVGQQ
AFSIMVPIFTAYIAWSISGRPGMVAGFVGGLLANATGAGFLGGIIAGFAAGYFMLLIRNM
LNGLPRQYEGLKSIFIMPLVGVLVIGVMMVLLGQPVAAINNAMMNWLSSLQEANPILLGI
VVGAMCSFDFGGPVNKAAYVTGTLLLGQGNYFFMAGVSAACITPPLVIALATTFFPKGFS
EEERAAGMVNYILGCTHITEGAIPFAAKDPLRVIPMMMIASSISAVLSYSLQIQVPAPHG
GFLILPLVSKPLMWVLCILAGSACGAVMLGCWRLWQKRNQEATTLAGAIK