Protein Info for BWI76_RS24860 in Klebsiella michiganensis M5al

Annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR03828: 1-phosphofructokinase" amino acids 2 to 301 (300 residues), 322.1 bits, see alignment E=3e-100 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 2 to 301 (300 residues), 319.6 bits, see alignment E=1.7e-99 PF00294: PfkB" amino acids 11 to 287 (277 residues), 157.7 bits, see alignment E=2.2e-50

Best Hits

Swiss-Prot: 33% identical to K1PF_BACSU: 1-phosphofructokinase (fruK) from Bacillus subtilis (strain 168)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 84% identity to kpu:KP1_4848)

Predicted SEED Role

"Tagatose-1-phosphate kinase TagK" in subsystem D-Tagatose and Galactitol Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.56

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA10 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BWI76_RS24860 1-phosphofructokinase (Klebsiella michiganensis M5al)
MIHTLTLNTAIDMNIFCDPLKPSAVNRTRHTEYCPNGKGVNVSLILNHYQQPTHIIGIFG
GFTGRYIVEELRQKKIKVTPAWVSEPTRINIFINDGAEEYKLVNPGAKIDDECKQQVIHH
LQCVASGDYLAISGSLPPGIESRFYAEIIELCQQKRCEVILDISHPVLRQLLELRPLLIK
PNDDELREIFGLDVSNHQQVREAMRTLHQLGARNVLLTMGAEGLYFSDGEGVWFCSAPKI
ALVSSACAGDAALGAFLSKWLNKEDVAHALALASATGADVAGSAGLGKLQRTEELLQQIQ
VVQL