Protein Info for BWI76_RS24840 in Klebsiella michiganensis M5al

Annotation: galactarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 TIGR03248: galactarate dehydratase" amino acids 15 to 523 (509 residues), 933.9 bits, see alignment E=9.6e-286 PF08666: SAF" amino acids 23 to 91 (69 residues), 38.5 bits, see alignment E=2.1e-13 PF04295: GD_AH_second" amino acids 122 to 270 (149 residues), 126.5 bits, see alignment E=1.2e-40 PF20629: GD_AH_C" amino acids 279 to 520 (242 residues), 311.1 bits, see alignment E=7.1e-97

Best Hits

Swiss-Prot: 93% identical to GARD_ECOLI: Galactarate dehydratase (L-threo-forming) (garD) from Escherichia coli (strain K12)

KEGG orthology group: K01708, galactarate dehydratase [EC: 4.2.1.42] (inferred from 96% identity to kpe:KPK_0570)

MetaCyc: 93% identical to GarD (Escherichia coli K-12 substr. MG1655)
Galactarate dehydratase. [EC: 4.2.1.42]

Predicted SEED Role

"D-galactarate dehydratase (EC 4.2.1.42)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAA4 at UniProt or InterPro

Protein Sequence (523 amino acids)

>BWI76_RS24840 galactarate dehydratase (Klebsiella michiganensis M5al)
MADIEIRQESPTAFYIKVHETDNVAIIVNDRGLTAGTRFPDGLTLVEHIPQGHKVALVDI
PVHGEIIRYGEVIGYAVRDIPQGSWIDESLVELPKAPPLHTLPLATKVPAPLPPLEGYTF
EGYRNADGSVGTKNLLGISTSVHCVAGVVDYVVKIIERDLLPKYPNVDGVVGLNHLYGCG
VAINAPAAVVPIRTIHNLALNPNFGGEVMVIGLGCEKLQPERLLEGTDDVKGIPVDSASI
VSLQDEKHVGFKSMVDDILQVAERHLEKLNQRQRETCPASELVVGMQCGGSDAFSGVTAN
PAVGYASDLLVRCGATVMFSEVTEVRDAIHLLTPRAINEEVGKRLLEEMAWYDNYLDMGK
TDRSANPSPGNKKGGLANVVEKALGSIAKSGKSAIAEVLSPGQRPTKRGLIYAATPASDF
VCGTQQVASGITVQVFTTGRGTPYGLVAVPVIKMATRTELANRWYDLMDINAGTIATGEE
TIEEVGLKLFEFILDVASGRKKTFSDQWGLHNQLAVFNPAPVT